6AEEADGH

Crystal structure of the four ig-like domains of lilrb1 complexed with hla-g
G: 28-32,147-154,161-170,195-199,309-316 H: 28-32,136-144,147-154,161-170,195-199,309-316
Link type Probability Loop ranges Chain A piercings Chain D piercings Chain G piercings Chain H piercings
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
view details
Other Other 37% -A +103H -179H -242H +267H -295H -396H -276A -277A
Interpreting sequences
Chain A Sequence
SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSASPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLIRGYERYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQ
Chain A Sequence
SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSASPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLIRGYERYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQ
Chain A Sequence
HLPKPTLWAEPGSVITQGSPVTLRCQG---TQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNS------SSRAIFSV--------WWYRCYAYDSNSPYEWSLPSDLLELL---VSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQP------GENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELHH
Chain A Sequence
HLPKPTLWAEPGSVITQGSPVTLRCQG---TQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKE-------CLNS------SSRAIFSV--------WWYRCYAYDSNSPYEWSLPSDLLELL---VSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQP------GENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELHH
sequence length 275,275,395,395
structure length 275,275,369,362
publication title Structures of the four Ig-like domain LILRB2 and the four-domain LILRB1 and HLA-G1 complex.
pubmed doi rcsb
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, alpha chain G
source organism Homo sapiens
missing residues G: 28-32,147-154,161-170,195-199,309-316 H: 28-32,136-144,147-154,161-170,195-199,309-316
pdb deposition date2018-08-04
LinkProt deposition date2019-08-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling