6ADLAC

Anthrax toxin receptor 1-bound spent particles of seneca valley virus in acidic conditions
C: 58-67
Link type Probability Loop ranges Chain A piercings Chain C piercings
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
view details
Hopf.2 Hopf.2 35% -A -44C -47C +238C -259A
Interpreting sequences
Chain A Sequence
NHTNVKFLFDRSRLLNVIKVLEKDAVFPRPFPTATGTQQDDGYFCLLTPRPTVASRPATRFGLYVSPSDSGVLANTSLDFNFYSLACFTYFRSDLEVTVVSLEPDLEFAVGWFPSGSEYQASSFVYDQLHVPYHFTGRTPRAFASKGGKVSFVLPWNSVSSVLPVRWGGASKLSSATRGLPAHADWGTIYAFIPRPNEKKSTAVKHVAVYIRYKNARAWCPSMLPFRSYK
Chain A Sequence
GPIPTAPRENSLMFLSTTPDDTVPAYGNVRTPPVNYLPGEITDLLQLARIPTLMAFGR--------DAYVPYVAVPTQFDDKPLISFPITLSDPVYQNTLVGAISSNFANYRGCIQITLTFCGPMMARGKFLLSYSPPNGTQPQTLSEAMQCTYSIWDIGLNSSWTFVIPYISPSDYRETRAITNSVYSADGWFSLHKLTKITLPPDCPQSPCILFFASAGEDYTLRLPVDCNPSYVF
sequence length 230,238
structure length 230,230
publication title Seneca Valley virus attachment and uncoating mediated by its receptor anthrax toxin receptor 1.
pubmed doi rcsb
molecule tags Virus
molecule keywords VP1
source organism Homo sapiens
missing residues C: 58-67
pdb deposition date2018-08-01
LinkProt deposition date2019-12-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling