6AD7ABDF

Crystal structure of the e148d mutant clc-ec1 in 20 mm bromide
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain D piercings Chain F piercings
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
view details
Other Other 35% -A -207B -459B -459B -410D -461D -461D -212F -212F +47A -190A +227A -245A -387A -461A -211D -211D -211D -31F -220F -223F -211A -459B
Interpreting sequences
Chain A Sequence
RRRQLIRQLLERDKTPLAILFMAAVVGTLVGLAAVAFDKGVAWLQNQRMGALVHTADNYPLLLTVAFLCSAVLAMFGYFLVRKYAPEAGGSGIPEIEGALEDQRPVRWWRVLPVKFFGGLGTLGGGMVLGRDGPTVQIGGNIGRMVLDIFRLKGDEARHTLLATGAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIGVIMSTIMYRIFNHEVALIDVGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLHRVHGGNITKWVLMGGAIGGLCGLLGFVAPATSGGGFNLIPIATAGNFSMGMLVFIFVARVITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLAASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQFTGGKPLYSAILARTLAKQEAEQ
Chain A Sequence
RRRQLIRQLLERDKTPLAILFMAAVVGTLVGLAAVAFDKGVAWLQNQRMGALVHTADNYPLLLTVAFLCSAVLAMFGYFLVRKYAPEAGGSGIPEIEGALEDQRPVRWWRVLPVKFFGGLGTLGGGMVLGRDGPTVQIGGNIGRMVLDIFRLKGDEARHTLLATGAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIGVIMSTIMYRIFNHEVALIDVGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLHRVHGGNITKWVLMGGAIGGLCGLLGFVAPATSGGGFNLIPIATAGNFSMGMLVFIFVARVITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLAASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQFTGGKPLYSAILARTLAKQEA
Chain A Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Chain A Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
sequence length 444,442,211,211
structure length 444,442,211,211
publication title Mutation of external glutamate residue reveals a new intermediate transport state and anion binding site in a CLC Cl-/H+antiporter.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords H(+)/Cl(-) exchange transporter ClcA
source organism Escherichia coli (strain k12)
pdb deposition date2018-07-31
LinkProt deposition date2019-08-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling