6A9PBGH

Crystal structure of the human glial fibrillary acidic protein 1b domain
Link type Probability Loop ranges Chain B piercings Chain G piercings Chain H piercings
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
view details
Hopf.2 U Ring Hopf.2 U Ring 46% -B -209B -213H -179G +212G
Interpreting sequences
Chain B Sequence
TKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQ
Chain B Sequence
TKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQ
Chain B Sequence
HMTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEV
sequence length 103,103,101
structure length 103,103,101
publication title Crystal structure of the human glial fibrillary acidic protein 1B domain
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Glial fibrillary acidic protein
source organism Homo sapiens
pdb deposition date2018-07-14
LinkProt deposition date2018-09-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling