6A6XABCD

The crystal structure of the mtb maze-mazf-mt9 complex
A: 16-24 B: 17-23
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
view details
Other Other 32% -A +76D +60A -103A +115A -56C -115D +5A +114B -56D -56D -56D
Interpreting sequences
Chain A Sequence
GPELMAEPRRGDLWLVSLGA-------KHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGVRAVARARLVERLGALKPATMRAIENALTLILGLPT
Chain A Sequence
LMAEPRRGDLWLVSLGAA-----GKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGVRAVARARLVERLGALKPATMRAIENALTLILGLP
Chain A Sequence
STSTTIRVSTQTRDRLAAQARERGISMSALLTELAAQAERQAIFRAEREASHAETTTQAVRDEDREWEGTVGDGL
Chain A Sequence
TSTTIRVSTQTRDRLAAQARERGISMSALLTELAAQAERQAIFRAEREASHAET
sequence length 119,115,75,54
structure length 112,110,75,54
publication title Structural and biochemical characterization on the cognate and heterologous interactions of the MazEF-mt9 TA system
rcsb
molecule tags Toxin
molecule keywords Probable endoribonuclease MazF7
source organism Mycobacterium tuberculosis
missing residues A: 16-24 B: 17-23
pdb deposition date2018-06-29
LinkProt deposition date2019-07-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling