6A6GABCD

Crystal structure of thermostable fisufs-sufu complex from thermophilic fervidobacterium islandicum aw-1
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
view details
Other Other 32% -A +5D +421A -133C +52D -72D +236D -288D -422D
Interpreting sequences
Chain A Sequence
MRSTVFSDEEFSNILNDFPALKRNINGKRLVYLDNAASTLKCKSVIEKMTDFYLYHYSNIHRAVHTLASEATVAYEQAREKVANFLNASSEEIIFTSGTTMGINFLVNSLAKSGILKTEDTVLISQVEHHANLVPWVRLSKFYGFKVAYITADEKGVITNESILKTKESIPNPKVVSITGQSNVTGQEMPIELIRETFKNATLIVDGAQLVPHKKVDVKKLDVDFLVFSGHKILGPTGIGVLYGKKALLEQLEPFLYGGEMIDKVTFEDVTFNVLPYRFEAGTQHITGAVGLGYTIDYLESIGFEKVEKHVEELSNYLLEKMMELDFVEVYGPIDSSHKSLVSFNVKGVHPHDVSHILDENFGVATRSGHHAQPLMGVLAKGSKIDFPNSTVRASVYLYNTKEDIDVLIEGLKYIRRWFE
Chain A Sequence
HMRSTVFSDEEFSNILNDFPALKRNINGKRLVYLDNAASTLKCKSVIEKMTDFYLYHYSNIHRAVHTLASEATVAYEQAREKVANFLNASSEEIIFTSGTTMGINFLVNSLAKSGILKTEDTVLISQVEHHANLVPWVRLSKFYGFKVAYITADEKGVITNESILKTKESIPNPKVVSITGQSNVTGQEMPIELIRETFKNATLIVDGAQLVPHKKVDVKKLDVDFLVFSGHKILGPTGIGVLYGKKALLEQLEPFLYGGEMIDKVTFEDVTFNVLPYRFEAGTQHITGAVGLGYTIDYLESIGFEKVEKHVEELSNYLLEKMMELDFVEVYGPIDSSHKSLVSFNVKGVHPHDVSHILDENFGVATRSGHHAQPLMGVLAKGSKIDFPNSTVRASVYLYNTKEDIDVLIEGLKYIRRWFE
Chain A Sequence
GSHMIYSEFIMDYSKLKKFHGKIENAHKVEEGKNLSGDEVTLYFLFDGDKIVDVKFEGHGCAISQASTNVMIEQIIGKTKQEALEMMKNAENMMLGKEFDENVLGPIINFYDVKNYPMRVKCFLLPWKTLEIALK
Chain A Sequence
MIYSEFIMDYSKLKKFHGKIENAHKVEEGKNLSGDEVTLYFLFDGDKIVDVKFEGHGCAISQASTNVMIEQIIGKTKQEALEMMKNAENMMLGKEFDENVLGPIINFYDVKNYPMRVKCFLLPWKTLEIALK
sequence length 421,422,136,133
structure length 420,421,135,132
publication title Crystal structure of thermostable Cysteine desulfurase (FiSufS) from thermophilic Fervidobacterium Islandicum AW-1
rcsb
molecule tags Transferase
molecule keywords Cysteine desulfurase
source organism Fervidobacterium islandicum
pdb deposition date2018-06-27
LinkProt deposition date2019-10-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling