| Link type | Probability | Loop ranges | Chain A piercings | Chain B piercings | Chain D piercings | Chain I piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
| view details |
|
Other | 32% | -A | -286I | +136A -148A +167A -179A | -68A -97A +286A -286B -230I -231I -231I | |||||||||
Chain A Sequence |
VAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISD |
Chain A Sequence |
APLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIIS |
Chain A Sequence |
APLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIIS |
Chain A Sequence |
QVQLQESGPGLVKPSETLSLTCTVSGGSVNTGSYYWSWIRQPPGKGLEWIAYSSVSGTSNYNPSLKSRVTLTVDTSKNQFSLSVRSVTAADTAVYFCARLNYDILTGYYFFDFWGQGTLVIVSSASTKGPSVFPLAPSSKSASGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSSGTQTYICNVNHKPSNTKVDKRVEPKSCDKT |
| sequence length | 223,221,221,230 |
| structure length | 223,221,221,230 |
| publication title |
An Effective Neutralizing Antibody Against Influenza Virus H1N1 from Human B Cells.
pubmed doi rcsb |
| molecule tags | Viral protein/immune system |
| molecule keywords | Hemagglutinin |
| source organism | Influenza a virus (a/california/7/2009(h1n1)) |
| pdb deposition date | 2018-06-20 |
| LinkProt deposition date | 2019-03-30 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
