6A4KABCD

Human antibody 32d6 fab in complex with h1n1 influenza a virus ha1
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
view details
Other Other 35% -A -280D -287D -286A -286A
Interpreting sequences
Chain A Sequence
VAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISD
Chain A Sequence
APLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIIS
Chain A Sequence
VAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISD
Chain A Sequence
APLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIIS
sequence length 223,221,223,221
structure length 223,221,223,221
publication title An Effective Neutralizing Antibody Against Influenza Virus H1N1 from Human B Cells.
pubmed doi rcsb
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin
source organism Influenza a virus (a/california/7/2009(h1n1))
pdb deposition date2018-06-20
LinkProt deposition date2019-03-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling