6A0FABD

Crystal structure of human protein n-terminal asparagine amidohydrolase (ntan1) c75s mutant with asn-phe-ala-ala-arg peptide
A: 114-117
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain D piercings
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
view details
Other Other 40% -A -5A -307B
Interpreting sequences
Chain A Sequence
PLLVEGRRVRLPQSAGDLVRAHPPLEERARLLRGQSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSDDATTSHIVVLRHTGNGATCLTHCDGTDTKAEVPLIMNSIKSFSD--QCGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDRQEDDIHLVTLCVTELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGPEEQLRAARTLAGGPMISIYDAETEQLRIGPYSWTPFPHVDFWLHQDDKQILENLSTSPLAEPPHFVEHIRSTLMFLKKHPSPAHTLFSGNKALLYKKNEDGLWEKI
Chain A Sequence
PLLVEGRRVRLPQSAGDLVRAHPPLEERARLLRGQSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSDDATTSHIVVLRHTGNGATCLTHCDGTDTKAEVPLIMNSIKSFSDHAQCGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDRQEDDIHLVTLCVTELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGPEEQLRAARTLAGGPMISIYDAETEQLRIGPYSWTPFPHVDFWLHQDDKQILENLSTSPLAEPPHFVEHIRSTLMFLKKHPSPAHTLFSGNKALLYKKNEDGLWEKIS
Chain A Sequence
NFAA
sequence length 304,305,4
structure length 302,305,4
publication title Crystal structure of protein N-terminal asparagine amidohydrolase
rcsb
molecule tags Hydrolase
molecule keywords Protein N-terminal asparagine amidohydrolase
source organism Homo sapiens
missing residues A: 114-117
pdb deposition date2018-06-05
LinkProt deposition date2019-12-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling