Link type | Probability | Loop ranges | Chain A piercings | Chain B piercings | Chain D piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B | ||||||||||
view details |
![]() |
Other | 40% | -A | -5A -307B |
Chain A Sequence |
PLLVEGRRVRLPQSAGDLVRAHPPLEERARLLRGQSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSDDATTSHIVVLRHTGNGATCLTHCDGTDTKAEVPLIMNSIKSFSD--QCGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDRQEDDIHLVTLCVTELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGPEEQLRAARTLAGGPMISIYDAETEQLRIGPYSWTPFPHVDFWLHQDDKQILENLSTSPLAEPPHFVEHIRSTLMFLKKHPSPAHTLFSGNKALLYKKNEDGLWEKI |
Chain A Sequence |
PLLVEGRRVRLPQSAGDLVRAHPPLEERARLLRGQSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSDDATTSHIVVLRHTGNGATCLTHCDGTDTKAEVPLIMNSIKSFSDHAQCGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDRQEDDIHLVTLCVTELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGPEEQLRAARTLAGGPMISIYDAETEQLRIGPYSWTPFPHVDFWLHQDDKQILENLSTSPLAEPPHFVEHIRSTLMFLKKHPSPAHTLFSGNKALLYKKNEDGLWEKIS |
Chain A Sequence |
NFAA |
sequence length | 304,305,4 |
structure length | 302,305,4 |
publication title |
Crystal structure of protein N-terminal asparagine amidohydrolase
rcsb |
molecule tags | Hydrolase |
molecule keywords | Protein N-terminal asparagine amidohydrolase |
source organism | Homo sapiens |
missing residues | A: 114-117 |
pdb deposition date | 2018-06-05 |
LinkProt deposition date | 2019-12-13 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...