5ZUDBCDE

Fit r10 fab coordinates into the cryo-em of ev71 in complex with d6
E: 100-106,135-140
Link type Probability Loop ranges Chain B piercings Chain C piercings Chain D piercings Chain E piercings
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
view details
Other Other 37% -B -99C -319D -213B -213B -88C -172C +189C -240C
Interpreting sequences
Chain B Sequence
VAQLTIGNSTITTQEAANIIVGYGEWPSYCSDSDATAVDKPTRPDVSVNRFYTLDTKLWEKSSKGWYWKFPDVLTETGVFGQNAQFHYLYRSGFCIHVQCNASKFHQGALLVAVLPEYVIGTVAGGTGTEDTHPPYKQTQPGADGFELQHPYVLDAGIPISQLTVCPHQWINLRTNNCATIIVPYINALPFDSALNHCNFGLLVVPISPLDYDQGATPVIPITITLAPMCSEFAGLR
Chain B Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTG
Chain B Sequence
DIVLTQSPAIMSASPGEKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSRLAFGVPGRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNYTFGGGTNLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Chain B Sequence
EVKLVESGGGSVKPGGSLKLSCAASGFSFSTYGMSWVRQTPEKRLEWVATISGGGGYTYYPDSVKGRFTISRDNARNILYLQMSSLRSGDTAMYYCARRV-----YYFDYWGQGTTLTVSSPKTTPPSVYPLAPA----TNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
sequence length 237,239,212,220
structure length 237,239,212,212
publication title CRYO-EM structure of EV71 and its neutralizing antibody D6 Fab
rcsb
molecule tags Virus like particle
molecule keywords Capsid protein VP1
source organism Enterovirus a71
missing residues E: 100-106,135-140
pdb deposition date2018-05-07
LinkProt deposition date2019-12-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling