5ZUDABDE

Fit r10 fab coordinates into the cryo-em of ev71 in complex with d6
A: 210-218 E: 100-106,135-140
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain D piercings Chain E piercings
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
view details
Other Other 36% -A +5E -23E +33E -86E +98E +297A -221D -297E +3E -99E
Interpreting sequences
Chain A Sequence
HSTAETTLDSFFSRAGLVGEIDLPLKGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGEVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPT-------KDLEYGAMPNNMMGTFSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITTL
Chain A Sequence
VAQLTIGNSTITTQEAANIIVGYGEWPSYCSDSDATAVDKPTRPDVSVNRFYTLDTKLWEKSSKGWYWKFPDVLTETGVFGQNAQFHYLYRSGFCIHVQCNASKFHQGALLVAVLPEYVIGTVAGGTGTEDTHPPYKQTQPGADGFELQHPYVLDAGIPISQLTVCPHQWINLRTNNCATIIVPYINALPFDSALNHCNFGLLVVPISPLDYDQGATPVIPITITLAPMCSEFAGLR
Chain A Sequence
DIVLTQSPAIMSASPGEKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSRLAFGVPGRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNYTFGGGTNLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Chain A Sequence
EVKLVESGGGSVKPGGSLKLSCAASGFSFSTYGMSWVRQTPEKRLEWVATISGGGGYTYYPDSVKGRFTISRDNARNILYLQMSSLRSGDTAMYYCARRV-----YYFDYWGQGTTLTVSSPKTTPPSVYPLAPA----TNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
sequence length 225,237,212,220
structure length 218,237,212,212
publication title CRYO-EM structure of EV71 and its neutralizing antibody D6 Fab
rcsb
molecule tags Virus like particle
molecule keywords Capsid protein VP1
source organism Enterovirus a71
missing residues A: 210-218 E: 100-106,135-140
pdb deposition date2018-05-07
LinkProt deposition date2019-12-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling