| Link type | Probability | Loop ranges | Chain A piercings | Chain C piercings | Chain E piercings | Chain F piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
| view details |
|
Other | 32% | -A | -558F +589F | +638F -649F | ||||||||||
Chain A Sequence |
NLLRAIEAQQHLLQLTVWGIKQLQARLLAVERYLK |
Chain A Sequence |
NLLRAIEAQQHLLQLTVWGIKQLQARLLAVERYLK |
Chain A Sequence |
NLLRAIEAQQHLLQLTVWGIKQLQARLLAVERYLK |
Chain A Sequence |
MTWEEWDKIEYTKIELIKKS |
| sequence length | 35,35,35,24 |
| structure length | 35,35,35,20 |
| publication title |
Generation of a long-acting fusion inhibitor against HIV-1.
pubmed doi rcsb |
| molecule tags | Virus like particle |
| molecule keywords | Transmembrane protein gp41 |
| pdb deposition date | 2018-04-16 |
| LinkProt deposition date | 2019-03-09 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
