| Link type | Probability | Loop ranges | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 | 63% | -A | -17B -47B +60B | -58A | ||||||||
| view details |
|
Hopf.2 | 63% | -A | -17B -47B +60B | -58A | ||||||||
| view details |
|
Hopf.2 | 63% | -A | -17B -47B +60B | -58A | ||||||||
| view details |
|
Hopf.2 | 63% | -A | -17B -47B +60B | -58A | ||||||||
| view details |
|
Hopf.2 | 63% | -A | -17B -47B +60B | -58A | ||||||||
| view details |
|
Hopf.2 | 63% | -A | -17B -47B +60B | -58A | ||||||||
| view details |
|
Hopf.2 | 63% | -A | -17B -47B +60B | -58A | ||||||||
| view details |
|
Hopf.2 | 63% | -A | -17B -47B +60B | -58A | ||||||||
| view details |
|
Hopf.2 | 63% | -A | -17B -47B +60B | -58A | ||||||||
Chain A Sequence |
SKVYTAKGIRDRRVRLSVSTAIQFYDLQDRLGYDQPSKAIEWLIKAAAAAIDKL |
Chain A Sequence |
SKVYTAKGIRDRRVRLSVSTAIQFYDLQDRLGYDQPSKAIEWLIKAAAAAIDKLP |
| sequence length | 54,55 |
| structure length | 54,55 |
| publication title |
Crystal structure of TCP domain of PCF6 in Oryza sativa
rcsb |
| molecule tags | Transcription |
| molecule keywords | Putative transcription factor PCF6 |
| source organism | Oryza sativa subsp. japonica |
| pdb deposition date | 2018-03-26 |
| LinkProt deposition date | 2019-03-30 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
