| Link type | Probability | Loop ranges | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.1 | 63% | -A | +57B | +116A | ||||||||
| view details |
|
Hopf.1 | 63% | -A | +57B | +116A | ||||||||
| view details |
|
Hopf.1 | 63% | -A | +57B | +116A | ||||||||
| view details |
|
Hopf.1 | 63% | -A | +57B | +116A | ||||||||
| view details |
|
Hopf.1 | 63% | -A | +57B | +116A | ||||||||
Chain A Sequence |
SNPGGSQVDAEGNPFWEISDKRRVGISQFKKMDFINIREYYEAGGEMKPGKKGIGLTVDQYTAFLKAIPAINAELRSRGHDIT |
Chain A Sequence |
SNPGGSQVDAEGNPFWEISDKRRVGISQFKKMDFINIREYYEAGGEMKPGKKGIGLTVDQYTAFLKAIPAINAELRSRGHDI |
| sequence length | 83,82 |
| structure length | 83,82 |
| publication title |
The effect of phosphate ion on the ssDNA binding mode of MoSub1, a Sub1/PC4 homolog from rice blast fungus.
pubmed doi rcsb |
| molecule tags | Dna binding protein/dna |
| molecule keywords | MoSub1 |
| source organism | Magnaporthe oryzae (strain p131) |
| pdb deposition date | 2018-03-08 |
| LinkProt deposition date | 2019-03-30 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
