| Link type | Probability | Loop ranges | Chain E piercings | Chain F piercings | Chain K piercings | Chain L piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
| view details |
|
Other | 30% | -E | -102F +129F | |||||||||||
Chain E Sequence |
SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV |
Chain E Sequence |
ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH |
Chain E Sequence |
TPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWR |
Chain E Sequence |
SHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT |
| sequence length | 109,98,49,47 |
| structure length | 109,98,49,47 |
| publication title |
Structure of the intact 14-subunit human cytochrome c oxidase.
pubmed doi rcsb |
| molecule tags | Electron transport |
| molecule keywords | Cytochrome c oxidase subunit 1 |
| pdb deposition date | 2018-01-22 |
| LinkProt deposition date | 2019-03-02 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
