5Z62DIKL

Structure of human cytochrome c oxidase
Link type Probability Loop ranges Chain D piercings Chain I piercings Chain K piercings Chain L piercings
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
view details
Other Other 43% -D -158K +170K +157D -170D -8I +75I
Interpreting sequences
Chain D Sequence
SVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Chain D Sequence
PEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
Chain D Sequence
TPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWR
Chain D Sequence
SHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT
sequence length 144,73,49,47
structure length 144,73,49,47
publication title Structure of the intact 14-subunit human cytochrome c oxidase.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2018-01-22
LinkProt deposition date2019-03-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling