5Z62DFGH

Structure of human cytochrome c oxidase
Link type Probability Loop ranges Chain D piercings Chain F piercings Chain G piercings Chain H piercings
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
view details
Other Other 36% -D +150G -164G
Interpreting sequences
Chain D Sequence
SVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Chain D Sequence
ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
Chain D Sequence
SARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYED
Chain D Sequence
METKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
sequence length 144,98,75,82
structure length 144,98,75,82
publication title Structure of the intact 14-subunit human cytochrome c oxidase.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2018-01-22
LinkProt deposition date2019-03-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling