| Link type | Probability | Loop ranges | Chain B piercings | Chain I piercings | Chain M piercings | Chain N piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
| view details |
|
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
Chain B Sequence |
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL |
Chain B Sequence |
PEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK |
Chain B Sequence |
IHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRP |
Chain B Sequence |
RQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF |
| sequence length | 227,73,43,79 |
| structure length | 227,73,43,79 |
| publication title |
Structure of the intact 14-subunit human cytochrome c oxidase.
pubmed doi rcsb |
| molecule tags | Electron transport |
| molecule keywords | Cytochrome c oxidase subunit 1 |
| pdb deposition date | 2018-01-22 |
| LinkProt deposition date | 2019-03-02 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...