Link type | Probability | Loop ranges | Chain B piercings | Chain I piercings | Chain M piercings | Chain N piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I | |||||||||
view details |
![]() |
Other | 43% | -B | +75I +134M -32N | -227B | -32B -75I |
Chain B Sequence |
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL |
Chain B Sequence |
PEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK |
Chain B Sequence |
IHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRP |
Chain B Sequence |
RQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF |
sequence length | 227,73,43,79 |
structure length | 227,73,43,79 |
publication title |
Structure of the intact 14-subunit human cytochrome c oxidase.
pubmed doi rcsb |
molecule tags | Electron transport |
molecule keywords | Cytochrome c oxidase subunit 1 |
pdb deposition date | 2018-01-22 |
LinkProt deposition date | 2019-03-02 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...