5Z62AKLN

Structure of human cytochrome c oxidase
Link type Probability Loop ranges Chain A piercings Chain K piercings Chain L piercings Chain N piercings
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
view details
Other Other 49% -A +64N +64N +448A +451A -82L -514N -64A -75K
Interpreting sequences
Chain A Sequence
MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS
Chain A Sequence
TPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWR
Chain A Sequence
SHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT
Chain A Sequence
RQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
sequence length 513,49,47,79
structure length 513,49,47,79
publication title Structure of the intact 14-subunit human cytochrome c oxidase.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2018-01-22
LinkProt deposition date2019-03-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling