5Z62AKLM

Structure of human cytochrome c oxidase
Link type Probability Loop ranges Chain A piercings Chain K piercings Chain L piercings Chain M piercings
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
view details
Other Other 41% -A +78K +69L -94L +156L -396L +409L -454L +482L +64M +10A -93A +121A -132A +156A -202A +226A -69L +34M -51M -380M +405M -467M -64A -78K -27M
Interpreting sequences
Chain A Sequence
MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS
Chain A Sequence
TPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWR
Chain A Sequence
SHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT
Chain A Sequence
IHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRP
sequence length 513,49,47,43
structure length 513,49,47,43
publication title Structure of the intact 14-subunit human cytochrome c oxidase.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2018-01-22
LinkProt deposition date2019-03-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling