5Z62AGMN

Structure of human cytochrome c oxidase
Link type Probability Loop ranges Chain A piercings Chain G piercings Chain M piercings Chain N piercings
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
view details
Other Other 31% -A -109G -514M -69N +18A -472A -494A -81M -82M -254N +276N -298N -337N +367N -425N +68A +109G
Interpreting sequences
Chain A Sequence
MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS
Chain A Sequence
SARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYED
Chain A Sequence
IHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRP
Chain A Sequence
RQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
sequence length 513,75,43,79
structure length 513,75,43,79
publication title Structure of the intact 14-subunit human cytochrome c oxidase.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2018-01-22
LinkProt deposition date2019-03-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling