| Link type | Probability | Loop ranges | Chain A piercings | Chain D piercings | Chain L piercings | Chain M piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
| view details |
|
Other | 41% | -A | -170D +164L -194L +243L -290L +484L -495L -513L +34M | +514A +37L -69L -69L +34M -51M -379M +405M -464M | -69M | |||||||||
Chain A Sequence |
MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS |
Chain A Sequence |
SVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK |
Chain A Sequence |
SHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT |
Chain A Sequence |
IHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRP |
| sequence length | 513,144,47,43 |
| structure length | 513,144,47,43 |
| publication title |
Structure of the intact 14-subunit human cytochrome c oxidase.
pubmed doi rcsb |
| molecule tags | Electron transport |
| molecule keywords | Cytochrome c oxidase subunit 1 |
| pdb deposition date | 2018-01-22 |
| LinkProt deposition date | 2019-03-02 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
