5Z62ACHL

Structure of human cytochrome c oxidase
Link type Probability Loop ranges Chain A piercings Chain C piercings Chain H piercings Chain L piercings
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
view details
Other Other 36% -A +261C +98H -156H +514H -86L -87L -102A +153A -205A -514A +64L
Interpreting sequences
Chain A Sequence
MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS
Chain A Sequence
THQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRDVTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS
Chain A Sequence
METKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Chain A Sequence
SHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT
sequence length 513,260,82,47
structure length 513,260,82,47
publication title Structure of the intact 14-subunit human cytochrome c oxidase.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2018-01-22
LinkProt deposition date2019-03-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling