5YNYABCD

Structure of house dust mite allergen der f 21 in peg2kmme
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
view details
Other Other 42% -A +13D -117D -116A -116B -74D +100D -115D
Interpreting sequences
Chain A Sequence
VPRGSEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVKDLAELAKKVKAVKS
Chain A Sequence
GLVPRGSEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVKDLAELAKKVKAVK
Chain A Sequence
RGSEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVKDLAELAKKVKAVK
Chain A Sequence
RGSEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVKDLAELAKKVKAV
sequence length 115,116,112,111
structure length 115,116,112,111
publication title Structure of house dust mite allergen Der F 21 in PEG2KMME
rcsb
molecule tags Allergen
molecule keywords Allergen Der f 21
source organism Dermatophagoides farinae
pdb deposition date2017-10-25
LinkProt deposition date2019-03-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling