5YI6ABCD

Crispr associated protein cas6
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
view details
Other Other 33% -A -5B +61B +119B -129B +155B -188B +207B -224B +238B +242C +179D +243A -243C -243D
Interpreting sequences
Chain A Sequence
RESMRIELELQTDNFTVIPYNHQYYLASAIYNKIHSANPAYAKRLHNYQKFKFFTFSLLQIRKRVIRKEGIETIDGKAYLYISSPNNEFIENFVAGLLEDGKLRVGNVEFFVRKAKILPIPKKFNILKTISPIYLKTMIETEDGLKTYDLLPNNSKFYENLKNNLKKKYEAFYNEKCDMNFEFEVLKFRPKRMRIKNDIYCRCSEMVFKVWGDYDLIKFGYECGFGEKNSMGFGMVVNVED
Chain A Sequence
ESMRIELELQTDNFTVIPYNHQYYLASAIYNKIHSANPAYAKRLHNYQKFKFFTFSLLQIRKRVIRKEGIETIDGKAYLYISSPNNEFIENFVAGLLEDGKLRVGNVEFFVRKAKILPIPKKFNILKTISPIYLKTMIETEDGLKTYDLLPNNSKFYENLKNNLKKKYEAFYNEKCDMNFEFEVLKFRPKRMRIKNDIYCRCSEMVFKVWGDYDLIKFGYECGFGEKNSMGFGMVVNVE
Chain A Sequence
RESMRIELELQTDNFTVIPYNHQYYLASAIYNKIHSANPAYAKRLHNYQKFKFFTFSLLQIRKRVIRKEGIETIDGKAYLYISSPNNEFIENFVAGLLEDGKLRVGNVEFFVRKAKILPIPKKFNILKTISPIYLKTMIETEDGLKTYDLLPNNSKFYENLKNNLKKKYEAFYNEKCDMNFEFEVLKFRPKRMRIKNDIYCRCSEMVFKVWGDYDLIKFGYECGFGEKNSMGFGMVVNVED
Chain A Sequence
ESMRIELELQTDNFTVIPYNHQYYLASAIYNKIHSANPAYAKRLHNYQKFKFFTFSLLQIRKRVIRKEGIETIDGKAYLYISSPNNEFIENFVAGLLEDGKLRVGNVEFFVRKAKILPIPKKFNILKTISPIYLKTMIETEDGLKTYDLLPNNSKFYENLKNNLKKKYEAFYNEKCDMNFEFEVLKFRPKRMRIKNDIYCRCSEMVFKVWGDYDLIKFGYECGFGEKNSMGFGMVVNVED
sequence length 241,239,241,240
structure length 241,239,241,240
publication title Expression, Purification, Crystallization, and X-ray Structural Analysis of CRISPR-Associated Protein Cas6 from Methanocaldococcus jannaschii
doi rcsb
molecule tags Hydrolase
molecule keywords CRISPR-associated endoribonuclease Cas6 1
source organism Methanocaldococcus jannaschii dsm 2661
pdb deposition date2017-10-03
LinkProt deposition date2018-09-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling