5Y2MBCKL

Crystal structure of a group 2 ha binding antibody af4h1k1 fab in complex with the h4n6 duck isolate (h4-cz/56) hemagglutinin
K: 161-167
Link type Probability Loop ranges Chain B piercings Chain C piercings Chain K piercings Chain L piercings
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
view details
Other Other 34% -B -249L -324B +52K +324L
Interpreting sequences
Chain B Sequence
GNPVICMGHHAVANGTMVKTLADDQVEVVTAQELVESQNLPELCPSPLRLVDGQTCDIINGALGSPGCDHLNGAEWDVFIERPNAVDTCYPFDVPEYQSLRSILANNGKFEFIAEEFQWNTVKQNGKSGACKRANVNDFFNRLNWLVKSDGNAYPLQNLTKINNGDYARLYIWGVHHPSTDTEQTNLYKNNPGGVTVSTKTSQTSVVPNIGSRPLVRGQSGRVSFYWTIVEPGDLIVFNTIGNLIAPRGHYKLNNQKKSTILNTAIPIGSCVSKCHTDKGSLSTTKPFQNISRIAVGDCPRYVKQGSLKLATGMRNIPE
Chain B Sequence
GNPVICMGHHAVANGTMVKTLADDQVEVVTAQELVESQNLPELCPSPLRLVDGQTCDIINGALGSPGCDHLNGAEWDVFIERPNAVDTCYPFDVPEYQSLRSILANNGKFEFIAEEFQWNTVKQNGKSGACKRANVNDFFNRLNWLVKSDGNAYPLQNLTKINNGDYARLYIWGVHHPSTDTEQTNLYKNNPGGVTVSTKTSQTSVVPNIGSRPLVRGQSGRVSFYWTIVEPGDLIVFNTIGNLIAPRGHYKLNNQKKSTILNTAIPIGSCVSKCHTDKGSLSTTKPFQNISRIAVGDCPRYVKQGSLKLATGMRNIPE
Chain B Sequence
QVQLVESGGGVVQPGTSLRLSCEASGFTSSAYAMHWVRQAPGKGLEWVAVITFDGGYQYYADSVKGRFTISRDISRNTLHLHMNSLRAEDTAVYYCARDPLTKLLPFDWVSGGYFDYWGQGTLVTVSSASTKGPSVFPLAPS-----GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Chain B Sequence
DIVMTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYRASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSFTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG
sequence length 319,319,229,212
structure length 319,319,224,212
publication title An H3-clade neutralizing antibody screened from an H7N9 patient that binds group 2 influenza A hemagglutinins
rcsb
molecule tags Immune system
molecule keywords Hemagglutinin
source organism Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6)
missing residues K: 161-167
pdb deposition date2017-07-26
LinkProt deposition date2019-02-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling