| Link type | Probability | Loop ranges | Chain A piercings | Chain C piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Unlink | 54% | -A | -31A +41A | |||||||||
| view details |
|
Unlink | 54% | -A | -31A +41A | |||||||||
| view details |
|
Unlink | 54% | -A | -31A +41A | |||||||||
| view details |
|
Unlink | 54% | -A | -31A +41A | |||||||||
| view details |
|
Unlink | 54% | -A | -31A +41A | |||||||||
| view details |
|
Unlink | 54% | -A | -31A +41A | |||||||||
Chain A Sequence |
APVPVTKLVCDGDTYKCTAYLDYGDGKWVAQWDTAVFHTT |
Chain A Sequence |
APVPVTKLVCDGDTYKCTAYLDYGDGKWVAQWDTAVFHTT |
| sequence length | 40,40 |
| structure length | 40,40 |
| publication title |
The trimeric solution structure and fucose-binding mechanism of the core fucosylation-specific lectin PhoSL.
pubmed doi rcsb |
| molecule tags | Sugar binding protein |
| molecule keywords | lectin (PhoSL) |
| pdb deposition date | 2017-07-12 |
| LinkProt deposition date | 2018-06-12 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
