5XV4BEJN

Crystal structure of atg101-atg13horma
E: 144-147
Link type Probability Loop ranges Chain B piercings Chain E piercings Chain J piercings Chain N piercings
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
view details
Other Other 40% -B -190E -119J +160J -207J +212J +168N -212N
Interpreting sequences
Chain B Sequence
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYAAAGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTT
Chain B Sequence
SQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQ--EYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYR
Chain B Sequence
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYAAAGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTT
Chain B Sequence
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYAAAGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLI
sequence length 207,184,207,212
structure length 207,182,207,212
publication title Crystal structure of ATG101-ATG13HORMA
rcsb
molecule tags Protein binding
molecule keywords Autophagy-related protein 13
source organism Homo sapiens
missing residues E: 144-147
pdb deposition date2017-06-26
LinkProt deposition date2018-07-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling