5XNCABCD

Crystal structure of the branched-chain polyamine synthase (bpsa) in complex with n4-aminopropylspermidine and 5-methylthioadenosine
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
view details
Other Other 39% -A -352D -351A -352C -352D -194A -351B
Interpreting sequences
Chain A Sequence
SHMREIIERVKEKTTIPVYERTIENVLSAIQASGDVWRIVDLSEEPLPLVVAVVTALYELGYVAFENNQVILTRKGKELVEKYGIGPRADYTCSHCQGRTVEIDAFSELLEQFKEITRDRPEPAHQFDQAYVTPETTVARVALMHSRGDLENKEVFVLGDDDLTSVALMLSGLPKRIAVLDIDERLTKFIEKAADEIGYENIEIFTFDLRKPLPDYALHKFDTFITDPPETVEAIRAFVGRGIATLKGPGCAGYFGITRRESSLDKWREIQRVLLNEFGVVITDIIRNFNEYVNWGYVEETRAWRLLPIKVKPSYNWYKSYMFRIQTLEGSKGFEDEITVGQELYDDEESSTT
Chain A Sequence
GSHMREIIERVKEKTTIPVYERTIENVLSAIQASGDVWRIVDLSEEPLPLVVAVVTALYELGYVAFENNQVILTRKGKELVEKYGIGPRADYTCSHCQGRTVEIDAFSELLEQFKEITRDRPEPAHQFDQAYVTPETTVARVALMHSRGDLENKEVFVLGDDDLTSVALMLSGLPKRIAVLDIDERLTKFIEKAADEIGYENIEIFTFDLRKPLPDYALHKFDTFITDPPETVEAIRAFVGRGIATLKGPGCAGYFGITRRESSLDKWREIQRVLLNEFGVVITDIIRNFNEYVNWGYVEETRAWRLLPIKVKPSYNWYKSYMFRIQTLEGSKGFEDEITVGQELYDDEESSTT
Chain A Sequence
SHMREIIERVKEKTTIPVYERTIENVLSAIQASGDVWRIVDLSEEPLPLVVAVVTALYELGYVAFENNQVILTRKGKELVEKYGIGPRADYTCSHCQGRTVEIDAFSELLEQFKEITRDRPEPAHQFDQAYVTPETTVARVALMHSRGDLENKEVFVLGDDDLTSVALMLSGLPKRIAVLDIDERLTKFIEKAADEIGYENIEIFTFDLRKPLPDYALHKFDTFITDPPETVEAIRAFVGRGIATLKGPGCAGYFGITRRESSLDKWREIQRVLLNEFGVVITDIIRNFNEYVNWGYVEETRAWRLLPIKVKPSYNWYKSYMFRIQTLEGSKGFEDEITVGQELYDDEESSTT
Chain A Sequence
SHMREIIERVKEKTTIPVYERTIENVLSAIQASGDVWRIVDLSEEPLPLVVAVVTALYELGYVAFENNQVILTRKGKELVEKYGIGPRADYTCSHCQGRTVEIDAFSELLEQFKEITRDRPEPAHQFDQAYVTPETTVARVALMHSRGDLENKEVFVLGDDDLTSVALMLSGLPKRIAVLDIDERLTKFIEKAADEIGYENIEIFTFDLRKPLPDYALHKFDTFITDPPETVEAIRAFVGRGIATLKGPGCAGYFGITRRESSLDKWREIQRVLLNEFGVVITDIIRNFNEYVNWGYVEETRAWRLLPIKVKPSYNWYKSYMFRIQTLEGSKGFEDEITVGQELYDDEESSTT
sequence length 353,354,353,353
structure length 353,354,353,353
publication title Active site geometry of a novel aminopropyltransferase for biosynthesis of hyperthermophile-specific branched-chain polyamine.
pubmed doi rcsb
molecule tags Transferase
molecule keywords N(4)-bis(aminopropyl)spermidine synthase
source organism Thermococcus kodakarensis (strain atcc baa-918 / jcm 12380 / kod1)
pdb deposition date2017-05-22
LinkProt deposition date2018-08-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling