| Link type | Probability | Loop ranges | Chain B piercings | Chain E piercings | Chain F piercings | Chain G piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
| view details |
|
Other | 33% | -B | -91E -28F | -40B -38E -57E +77E +72G | ||||||||||
Chain B Sequence |
ELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEV----------KPVNKDRYISKMFLRGDSVIVVLRNPLIAG |
Chain B Sequence |
MVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSV |
Chain B Sequence |
LPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVE |
Chain B Sequence |
KKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMA--GQQNNIGMVVIRGNSIIMLEA |
| sequence length | 103,77,74,63 |
| structure length | 93,77,74,61 |
| publication title |
Structures of 7S mutant complexes
rcsb |
| molecule tags | Splicing |
| molecule keywords | Gem-associated protein 2 |
| source organism | Homo sapiens |
| missing residues | B: 77-88 G: 49-52 |
| pdb deposition date | 2017-05-04 |
| LinkProt deposition date | 2018-07-07 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
