5WRJABFH

Crystal structure of human tyrosylprotein sulfotransferase-1 complexed with pap and gastrin peptide
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain F piercings Chain H piercings
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
view details
Other Other 36% -A -1006H -75A +110H -179H
Interpreting sequences
Chain A Sequence
AYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKP
Chain A Sequence
AYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKP
Chain A Sequence
EEAY
Chain A Sequence
EEAY
sequence length 275,275,4,4
structure length 275,275,4,4
publication title Structural basis for the broad substrate specificity of the human tyrosylprotein sulfotransferase-1.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Protein-tyrosine sulfotransferase 1
source organism Homo sapiens
pdb deposition date2016-12-02
LinkProt deposition date2017-09-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling