5WRJABCD

Crystal structure of human tyrosylprotein sulfotransferase-1 complexed with pap and gastrin peptide
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
view details
Other Other 30% -A -101C +143C +337D +335A -338C -296D -336A -339B +227D +338D
Interpreting sequences
Chain A Sequence
AYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKP
Chain A Sequence
AYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKP
Chain A Sequence
AYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYG
Chain A Sequence
AYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKP
sequence length 275,275,273,275
structure length 275,275,273,275
publication title Structural basis for the broad substrate specificity of the human tyrosylprotein sulfotransferase-1.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Protein-tyrosine sulfotransferase 1
source organism Homo sapiens
pdb deposition date2016-12-02
LinkProt deposition date2017-09-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling