| Link type | Probability | Loop ranges | Chain G piercings | Chain H piercings | Chain U piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 U Ring | 38% | -G | -86H -118U | ||||||||||
| view details |
|
Hopf.2 U Ring | 38% | -G | -86H -118U | ||||||||||
| view details |
|
Hopf.2 U Ring | 38% | -G | -86H -118U | ||||||||||
| view details |
|
Hopf.2 U Ring | 38% | -G | -86H -118U | ||||||||||
| view details |
|
Hopf.2 U Ring | 38% | -G | -86H -118U | ||||||||||
| view details |
|
Hopf.2 U Ring | 38% | -G | -86H -118U | ||||||||||
| view details |
|
Hopf.2 U Ring | 38% | -G | -86H -118U | ||||||||||
| view details |
|
Hopf.2 U Ring | 38% | -G | -86H -118U | ||||||||||
| view details |
|
Hopf.2 U Ring | 38% | -G | -86H -118U | ||||||||||
| view details |
|
Hopf.2 U Ring | 38% | -G | -86H -118U | ||||||||||
| view details |
|
Hopf.2 U Ring | 38% | -G | -86H -118U | ||||||||||
Chain G Sequence |
SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK |
Chain G Sequence |
KRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS |
Chain G Sequence |
SASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAK |
| sequence length | 103,93,76 |
| structure length | 103,93,76 |
| publication title |
Revisit of Reconstituted 30-nm Nucleosome Arrays Reveals an Ensemble of Dynamic Structures.
pubmed doi rcsb |
| molecule tags | Chromatin binding protein/dna |
| molecule keywords | Histone H3 |
| source organism | Drosophila melanogaster |
| pdb deposition date | 2017-07-02 |
| LinkProt deposition date | 2018-11-02 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
