| Link type | Probability | Loop ranges | Chain A piercings | Chain B piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
| view details |
|
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
| view details |
|
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
| view details |
|
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
| view details |
|
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
| view details |
|
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
| view details |
|
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
| view details |
|
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
| view details |
|
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
| view details |
|
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
| view details |
|
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
| view details |
|
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
| view details |
|
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
| view details |
|
Hopf.2 U Ring | 51% | -A | -255B -278D | +162D -174D | |||||||||
Chain A Sequence |
DHCARHGEKLLLFCQEDSKVICWLCKDSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISELEHRLQGSMMDLLQGVDGIIKRIENMTLKKPKTFHKNQRRVFRAPDLKGML |
Chain A Sequence |
DHCARHGEKLLLFCQEDSKVICWLCKDSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISELEHRLQGSMMDLLQGVDGIIKRIENMTLKKPKTFHKNQRRV--APDLKGML |
Chain A Sequence |
EKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQ |
| sequence length | 193,193,113 |
| structure length | 193,191,113 |
| publication title |
A helical LIR mediates the interaction between the retroviral restriction factor Trim5alpha and the mammalian autophagy related ATG8 proteins
rcsb |
| molecule tags | Antiviral protein |
| molecule keywords | Tripartite motif-containing protein 5 |
| source organism | Macaca mulatta |
| missing residues | B: 277-280 |
| pdb deposition date | 2017-06-22 |
| LinkProt deposition date | 2018-10-13 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
