5W9AABCD

The structure of the trim5alpha bbox- coiled coil in complex lc3b
B: 277-280
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 40% -A -255B -255C +273C -288C
Interpreting sequences
Chain A Sequence
DHCARHGEKLLLFCQEDSKVICWLCKDSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISELEHRLQGSMMDLLQGVDGIIKRIENMTLKKPKTFHKNQRRVFRAPDLKGML
Chain A Sequence
DHCARHGEKLLLFCQEDSKVICWLCKDSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISELEHRLQGSMMDLLQGVDGIIKRIENMTLKKPKTFHKNQRRV--APDLKGML
Chain A Sequence
EKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQE
Chain A Sequence
EKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQ
sequence length 193,193,114,113
structure length 193,191,114,113
publication title A helical LIR mediates the interaction between the retroviral restriction factor Trim5alpha and the mammalian autophagy related ATG8 proteins
rcsb
molecule tags Antiviral protein
molecule keywords Tripartite motif-containing protein 5
source organism Macaca mulatta
missing residues B: 277-280
pdb deposition date2017-06-22
LinkProt deposition date2018-10-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling