5W27AB

Crystal structure of tnms3 in complex with tiancimycin (tnm b)
Link type Probability Loop ranges Chain A piercings Chain B piercings
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
view details
Hopf.2 Hopf.2 44% -A -8B +28B -120B -6A
Interpreting sequences
Chain A Sequence
HMAISHVQLFSVPVSDQEKAKDFYVETVGFDLLADQPGVHGRWLQVAPKGADTSLVLVDWFPTMPPGSLRGLLLRTDDVDADCARLQERGVAVDGPKNTPWGRQAMFSDPDGNVIGLNQPS
Chain A Sequence
HMAISHVQLFSVPVSDQEKAKDFYVETVGFDLLADQPGVHGRWLQVAPKGADTSLVLVDWFPTMPPGSLRGLLLRTDDVDADCARLQERGVAVDGPKNTPWGRQAMFSDPDGNVIGLNQPS
sequence length 121,121
structure length 121,121
publication title Crystal structure of TnmS3 in complex with tiancimycin (TNM B)
rcsb
molecule tags Tiancimycin-binding protein
molecule keywords Glyoxalase/bleomycin resisance protein/dioxygenase
source organism Streptomyces sp. cb03234
pdb deposition date2017-06-05
LinkProt deposition date2018-06-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling