5VOKADEG

Crystal structure of the c7orf59-hbxip dimer
D: 55-62
Link type Probability Loop ranges Chain A piercings Chain D piercings Chain E piercings Chain G piercings
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
view details
Other Other 31% -A -52E +64E -91G -91G -59A -91A -91A -92D
Interpreting sequences
Chain A Sequence
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMA
Chain A Sequence
ALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRL------PFKRLSVVFGEHTLLVTVSGQRVFVVKRQNR
Chain A Sequence
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMA
Chain A Sequence
ATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMA
sequence length 90,89,90,88
structure length 90,83,90,88
publication title Crystal structure of C7orf59-HBXIP and insights into Ragulator assembly
rcsb
molecule tags Signaling protein
molecule keywords Ragulator complex protein LAMTOR5
source organism Homo sapiens
missing residues D: 55-62
pdb deposition date2017-05-03
LinkProt deposition date2018-05-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling