5VFONnot

Nucleotide-driven triple-state remodeling of the aaa-atpase channel in the activated human 26s proteasome
Link type Probability Loop ranges Chain N piercings Chain n piercings Chain o piercings Chain t piercings
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
view details
Other Other 33% -N +209o -18t +31t +192t
Interpreting sequences
Chain N Sequence
TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLG
Chain N Sequence
TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLG
Chain N Sequence
TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLE
Chain N Sequence
TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMI
sequence length 191,191,220,215
structure length 191,191,220,215
publication title Structural mechanism for nucleotide-driven remodeling of the AAA-ATPase unfoldase in the activated human 26S proteasome.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteasome subunit alpha type-6
source organism Homo sapiens
pdb deposition date2017-04-08
LinkProt deposition date2018-07-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling