5UTZBDFG

Human il-2/fab complex
B: 137-142 D: 98-102 F: 137-139
Link type Probability Loop ranges Chain B piercings Chain D piercings Chain F piercings Chain G piercings
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
view details
Other Other 49% -B +125G -150G +184G -224G -122F +136F -209F -225G -23B +36B +81B -112B
Interpreting sequences
Chain B Sequence
ELQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARTPTVTGDWFDPWGRGTLVTVSSASTKGPSVFPLAPSSK----GTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Chain B Sequence
SSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKG---TFMCEYADETATIVEFLNRWITFCQSIISTLT
Chain B Sequence
ELQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARTPTVTGDWFDPWGRGTLVTVSSASTKGPSVFPLAPSSK-TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Chain B Sequence
NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
sequence length 224,129,224,213
structure length 220,126,223,213
publication title A human anti-IL-2 antibody that potentiates regulatory T cells by a structure-based mechanism.
pubmed doi rcsb
molecule tags Cytokine/immune system
molecule keywords Fab 5111 heavy chain
source organism Homo sapiens
missing residues B: 137-142 D: 98-102 F: 137-139
pdb deposition date2017-02-15
LinkProt deposition date2018-07-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling