5T35DFGH

The protac mz1 in complex with the second bromodomain of brd4 and pvhl:elonginc:elonginb
G: 48-58
Link type Probability Chain D piercings Chain F piercings Chain G piercings Chain H piercings
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
view details
Other Other 38% -208G -210H +68D -94F +104F +104F
Interpreting sequences
Chain D Sequence
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQ
Chain D Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK
Chain D Sequence
MMYVKLISSDGHEFIVKREHALTSGTIKAMLSG---------NEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Chain D Sequence
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIA
sequence length 149,104,97,147
structure length 149,104,88,147
publication title Structural basis of PROTAC cooperative recognition for selective protein degradation
doi rcsb
molecule tags Ligase
molecule keywords Bromodomain-containing protein 4
source organism Homo sapiens
missing residues G: 48-58
pdb deposition date2016-08-24
LinkProt deposition date2017-03-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling