5T35BDEH

The protac mz1 in complex with the second bromodomain of brd4 and pvhl:elonginc:elonginb
Link type Probability Chain B piercings Chain D piercings Chain E piercings Chain H piercings
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
view details
Other Other 36% +186D +104E -182E -185E -104H -104H
Interpreting sequences
Chain B Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK
Chain B Sequence
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQ
Chain B Sequence
KVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Chain B Sequence
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIA
sequence length 104,149,111,147
structure length 104,149,111,147
publication title Structural basis of PROTAC cooperative recognition for selective protein degradation
doi rcsb
molecule tags Ligase
molecule keywords Bromodomain-containing protein 4
source organism Homo sapiens
pdb deposition date2016-08-24
LinkProt deposition date2017-03-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling