| Link type | Probability | Chain B piercings | Chain C piercings | Chain D piercings | Chain E piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
| view details |
|
Other | 34% | ||||||||||||
Chain B Sequence |
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK |
Chain B Sequence |
MMYVKLISSDGHEFIVKREHALTSGTIKAMLS----------NEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC |
Chain B Sequence |
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQ |
Chain B Sequence |
KVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD |
| sequence length | 104,97,149,111 |
| structure length | 104,87,149,111 |
| publication title |
Structural basis of PROTAC cooperative recognition for selective protein degradation
doi rcsb |
| molecule tags | Ligase |
| molecule keywords | Bromodomain-containing protein 4 |
| source organism | Homo sapiens |
| missing residues | C: 47-58 |
| pdb deposition date | 2016-08-24 |
| LinkProt deposition date | 2017-03-14 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
