5T0WABCD

Crystal structure of the ancestral amino acid-binding protein anccdt-1, a precursor of cyclohexadienyl dehydratase
A: 190-195 B: 190-195,201-204 C: 190-195 D: 190-196,200-205
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
view details
Other Other 33% -A +27A +68A -80A -247A +65C -246C
Interpreting sequences
Chain A Sequence
STLDEIMKRGTLRVGTDADYKPFSFKDKNGQYTGFDIDLAKALAKELGVKVEFVPTTWDGIIPALQTGKFDIVMSGMTITPERKKKVDFSDPYMTAGQTILVKKDNADKIKSFEDLNKPDVKVAVQLGTTSEQAAKEFLPKAKIRTFENNAEAFQEVVSGRADAMVTDSPVAAYYAK----LAVVVVDEPFTHEPLGFAIRKGDPELLNWVNNWLKQMKKDGTYDKLYEKWFK
Chain A Sequence
STLDEIMKRGTLRVGTDADYKPFSFKDKNGQYTGFDIDLAKALAKELGVKVEFVPTTWDGIIPALQTGKFDIVMSGMTITPERKKKVDFSDPYMTAGQTILVKKDNADKIKSFEDLNKPDVKVAVQLGTTSEQAAKEFLPKAKIRTFENNAEAFQEVVSGRADAMVTDSPVAAYYAK----LAVVVVD--FTHEPLGFAIRKGDPELLNWVNNWLKQMKKDGTYDKLYEKWFK
Chain A Sequence
STLDEIMKRGTLRVGTDADYKPFSFKDKNGQYTGFDIDLAKALAKELGVKVEFVPTTWDGIIPALQTGKFDIVMSGMTITPERKKKVDFSDPYMTAGQTILVKKDNADKIKSFEDLNKPDVKVAVQLGTTSEQAAKEFLPKAKIRTFENNAEAFQEVVSGRADAMVTDSPVAAYYAK----LAVVVVDEPFTHEPLGFAIRKGDPELLNWVNNWLKQMKKDGTYDKLYEKWFK
Chain A Sequence
ASTLDEIMKRGTLRVGTDADYKPFSFKDKNGQYTGFDIDLAKALAKELGVKVEFVPTTWDGIIPALQTGKFDIVMSGMTITPERKKKVDFSDPYMTAGQTILVKKDNADKIKSFEDLNKPDVKVAVQLGTTSEQAAKEFLPKAKIRTFENNAEAFQEVVSGRADAMVTDSPVAAYYAK-----AVVVV----THEPLGFAIRKGDPELLNWVNNWLKQMKKDGTYDKLYEKWFK
sequence length 233,233,233,234
structure length 229,227,229,225
publication title To be published
rcsb
molecule tags Transport protein
molecule keywords AncCDT-1
source organism Synthetic construct
missing residues A: 190-195 B: 190-195,201-204 C: 190-195 D: 190-196,200-205
pdb deposition date2016-08-16
LinkProt deposition date2017-09-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling