5QU6ACEH

Crystal structure of swapped human nck sh3.1 domain, 1.8a, triclinic
C: 33-35
Link type Probability Loop ranges Chain A piercings Chain C piercings Chain E piercings Chain H piercings
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
view details
Other Other 45% -A +60H +59A -62E -59H
Interpreting sequences
Chain A Sequence
EVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVER
Chain A Sequence
EEVVVVAKFDYVAQQEQELDIKKNERLWLL-DSKSWWRVRNSMNKTGFVPSNYVER
Chain A Sequence
SMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVER
Chain A Sequence
EVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS
sequence length 55,56,59,58
structure length 55,55,59,58
publication title Domain Swap in the first SH3 domain of human Nck1
rcsb
molecule tags Signaling protein
molecule keywords Cytoplasmic protein NCK1
source organism Homo sapiens
missing residues C: 33-35
pdb deposition date2019-12-13
LinkProt deposition date2020-02-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling