5QU2ABDE

Crystal structure of human nck sh3.1 in complex with peptide pppvpnpdy
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain D piercings Chain E piercings
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
view details
Other Other 30% -A +188E +188E
Interpreting sequences
Chain A Sequence
EVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERK
Chain A Sequence
EEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVER
Chain A Sequence
PPPVPNPDY
Chain A Sequence
PPPVPNPDY
sequence length 56,56,9,9
structure length 56,56,9,9
publication title Domain Swap in the first SH3 domain of human Nck1
rcsb
molecule tags Signaling protein
molecule keywords Cytoplasmic protein NCK1
source organism Homo sapiens
pdb deposition date2019-12-13
LinkProt deposition date2020-02-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling