| Link type | Probability | Loop ranges | Chain F piercings | Chain H piercings | Chain I piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
| view details |
|
Hopf.2 U Ring | 32% | -F | -578F -51I | -288F +338F -429F +530F -14H +104H | |||||||||
Chain F Sequence |
CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEP |
Chain F Sequence |
CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEP |
Chain F Sequence |
VNCETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWRE |
| sequence length | 103,103,465 |
| structure length | 103,103,465 |
| publication title |
Potent Triazolopyridine Myeloperoxidase Inhibitors.
pubmed doi rcsb |
| molecule tags | Metal binding protein |
| molecule keywords | Myeloperoxidase |
| source organism | Homo sapiens |
| pdb deposition date | 2018-09-26 |
| LinkProt deposition date | 2019-02-08 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
