5QJ2ABEF

Crystal structure of myeloperoxidase subform c (mpo) omplex with compound-20 aka 7-((3-(1-methyl-1h-pyrazol-3- yl)benzyl)oxy)- 1h-[1,2,3]triazolo[4,5-b]pyridin-5-amine
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain E piercings Chain F piercings
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
view details
Other Other 43% -A -281B +337B -378B -429B -577B -98E -103E -104E -577A -577A -114B -124B
Interpreting sequences
Chain A Sequence
CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEP
Chain A Sequence
VNCETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWRE
Chain A Sequence
VNCETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWRE
Chain A Sequence
CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEP
sequence length 103,465,465,103
structure length 103,465,465,103
publication title Potent Triazolopyridine Myeloperoxidase Inhibitors.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords Myeloperoxidase
source organism Homo sapiens
pdb deposition date2018-09-26
LinkProt deposition date2019-02-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling