5OYPABCD

Sacbrood virus of honeybee
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
view details
Other Other 42% -A -137B -244C -59D -273D -11A -228A -1C -244D +273A +240B
Interpreting sequences
Chain A Sequence
MDTGAKEDEDETANFSDGVTAMGFQSLDTQVSIKDILRRPVLLFNHVELDPDYTGFFIPIMPPSRMMQYKSGDKETSFQRLIGRTPQAAIMNLFRFWRGSLRYTIIIHSTDGHPIYVTHVPHTGNRVYGLMKVNNLHEYTKVPIFGCGLTTEMIIPSVNPSICVEVPFDTENNWAVTFDEDAQRNYSWRDKGDTVTGHLVVTPVVSVYMSVWVEAGDDFEVSNFYGPPSVKTNDWNYAFSDEH
Chain A Sequence
EVPSKESIQGDATQQSSKEENTIITRDQQQTVSENIPSTVGDLVIASSEPTQQFRSLTNRWMPINSIRVTVNGKRNDLLAQYYIPEDFLSTHAKCAPNTIPFETYVYGKYELEMKFVANGNKFQCGKVIISVKFDSYQADNINTGFQAALSRPHIMLDLSTNNEGVLKIPFRYHRAFVRNQTHKTATAGVRPGKFASIYVQVLSPLQTGEGGANDMFIRPFYRYTRAEFAGMSYKVPLT
Chain A Sequence
DKPKDVSSITIIPKPRLGFPHGKGKSDAVAMRVNPVALTSFQDVSAYPDEPRTTLDIARIWGLRSTFNWGSGDEHGKELFNTVLDPGLRFYDQDYEGQITPMEYVTGLYNFWSGPIELRFDFVSNAFHTGTVIISAEYNRSSTNTDECQSHSTYTKTFHLGEQKSVHFTVPYIYDTVVRRNTASAYLPVTDYDKVDNVSRAQAMGIRAESKMRVKVRVVNVLRPVASTTSTIEVLVYMRGGKNYALHGLKQSTYWPSNSVVPIDSFPPDGYDP
Chain A Sequence
DNPHRFLPANVSNRWNEYSSAYLPRV
sequence length 243,239,273,26
structure length 243,239,273,26
publication title Virion structure and genome delivery mechanism of sacbrood honeybee virus.
pubmed doi rcsb
molecule tags Virus
molecule keywords structural protein VP1
source organism Sacbrood virus
pdb deposition date2017-09-11
LinkProt deposition date2018-07-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling