5OYHABEF

Crystal structure of the catalytic core of a rhodopsin-guanylyl cyclase with converted specificity in complex with atpalphas
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain E piercings Chain F piercings
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
view details
Other Other 59% -A -555B +565B +572E -625E -581A +606A -618A -627B
Interpreting sequences
Chain A Sequence
MTEAKEYESVTVFFSDITNFTVISSRTSTKDMMATLNKLWLEYDAIAKRWGVYKVKTIGDAYLGVTGAPEVVPDHADRAVNFALDIIEMIKTFKTATGESINIRIGLNSGPVTAGVLGDLNPHWDLVGDTVNTASRMESTSKAGHIHISDSTYQMIKGKFVTQPLDLMEVKGKGKMQTYWVTAR
Chain A Sequence
TEAKEYESVTVFFSDITNFTVISSRTSTKDMMATLNKLWLEYDAIAKRWGVYKVKTIGDAYLGVTGAPEVVPDHADRAVNFALDIIEMIKTFKTATGESINIRIGLNSGPVTAGVLGDLNPHWDLVGDTVNTASRMESTSKAGHIHISDSTYQMIKGKFVTQPLDLMEVKGKGKMQTYWVTARK
Chain A Sequence
EAKEYESVTVFFSDITNFTVISSRTSTKDMMATLNKLWLEYDAIAKRWGVYKVKTIGDAYLGVTGAPEVVPDHADRAVNFALDIIEMIKTFKTATGESINIRIGLNSGPVTAGVLGDLNPHWDLVGDTVNTASRMESTSKAGHIHISDSTYQMIKGKFVTQPLDLMEVKGKGKMQTYWVTAR
Chain A Sequence
MTEAKEYESVTVFFSDITNFTVISSRTSTKDMMATLNKLWLEYDAIAKRWGVYKVKTIGDAYLGVTGAPEVVPDHADRAVNFALDIIEMIKTFKTATGESINIRIGLNSGPVTAGVLGDLNPHWDLVGDTVNTASRMESTSKAGHIHISDSTYQMIKGKFVTQPLDLMEVKGKGKMQTYWVTARK
sequence length 184,184,182,185
structure length 184,184,182,185
publication title Rhodopsin-cyclases for photocontrol of cGMP/cAMP and 2.3 angstrom structure of the adenylyl cyclase domain.
pubmed doi rcsb
molecule tags Lyase
molecule keywords Nucleotide cyclase
source organism Catenaria anguillulae pl171
pdb deposition date2017-09-09
LinkProt deposition date2018-06-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling