5OXXAB

Intein
Link type Probability Loop ranges Chain A piercings Chain B piercings
view details
Hopf.2 Hopf.2 70% -A -12B -77A
view details
Hopf.2 Hopf.2 70% -A -12B -77A
view details
Hopf.2 Hopf.2 70% -A -12B -77A
view details
Hopf.2 Hopf.2 70% -A -12B -77A
view details
Hopf.2 Hopf.2 70% -A -12B -77A
view details
Hopf.2 Hopf.2 70% -A -12B -77A
view details
Hopf.2 Hopf.2 70% -A -12B -77A
view details
Hopf.2 Hopf.2 70% -A -12B -77A
view details
Hopf.2 Hopf.2 70% -A -12B -77A
Interpreting sequences
Chain A Sequence
GDSIMDTEIEVIENGIKKKEKLSDLFNKYYAGFQIGEKHYAFPPDLYVYDGERWVKVYSIIKHETETDLYEINGITLSA
Chain A Sequence
RYLGKKRVILYDLSTESGKFYVNGLVLHN
sequence length 79,29
structure length 79,29
publication title Intein
rcsb
molecule tags Splicing
molecule keywords NEQ068
source organism Nanoarchaeum equitans (strain kin4-m)
pdb deposition date2017-09-07
LinkProt deposition date2018-10-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling